PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462858910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HD-ZIP
Protein Properties Length: 533aa    MW: 58987.4 Da    PI: 9.653
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462858910genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox39.59.5e-131091432256
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +p+++er++L++ +gL+e+qVk+WFqN+R++ k
  462858910 109 VEHPNENERQQLSETTGLSENQVKFWFQNKRTQVK 143
                578****************************9876 PP

2START81.52e-262504636206
                HHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.......EEEEEEEECTT... CS
      START   6 aaqelvkkalaeepgWvkss....esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdetla.......kaetlevissg... 88 
                a q + ++a++++p+W ++s    e +n++ ++q ++ +++    ++e+ ra +vv m++ ++v  l+d    + ++++       + ++++  s+    
  462858910 250 AVQKFASLASSSSPLWLSVSgdslETLNKMAYVQAIPWQNSvmgLKIETTRANAVVMMDSQNVVGFLMDAE-SYGTYFPgimfggtATKVYNWPSDRnag 348
                7899********************************998889*******************9999999999.**********999888888888877999 PP

                ..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHH CS
      START  89 ..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslv 185
                  ga +l +ae +++spl p R+ +f+R++++l+ g  ++ d++v++ + +       + ++  Sg+li+p +   +k+t +ehv ++++ +h l+++ +
  462858910 349 ydGAMELLTAEVVFPSPLIPaRKCTFLRCCKKLENGATAVIDIAVQNIAGNF-----LKYRKVASGLLIQPIKPDSCKITAIEHVRVDDAGIHDLFKPCL 443
                **********************************************999975.....67778************************************99 PP

                HHHHHHHHHHHHHHTXXXXXX CS
      START 186 ksglaegaktwvatlqrqcek 206
                +  l +ga++wv  + rqc++
  462858910 444 S-ALLFGARRWVVSMARQCAR 463
                5.799*************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.8E-1096143IPR009057Homeodomain-like
SMARTSM003893.4E-4100149IPR001356Homeobox domain
PfamPF000463.2E-10109143IPR001356Homeobox domain
PROSITE profilePS5007112.082110145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.3E-11110143IPR009057Homeodomain-like
CDDcd000861.18E-8111143No hitNo description
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
PROSITE profilePS5084819.703236466IPR002913START domain
SuperFamilySSF559611.92E-16241463No hitNo description
SMARTSM002340.005245463IPR002913START domain
PfamPF018524.5E-18250463IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MGDQRNRHPS QPQASRIGRL SAVAESGVFL RVQTKQALRV LFLFQSDTSE KSSSSNQPEI  60
PHATTGARAL RPNELDSSVS IYSKQIRGEG PSDGPDGSQA KKKRLHSTVE HPNENERQQL  120
SETTGLSENQ VKFWFQNKRT QVKCLKGKEE NYRLKAENAI LKDENKRLKQ AKMTISCPSC  180
SGSSTKPPIL QEIERLKSEN GWIQQELARL NSGLPMNSNA PRHVFQHGSS SGNVVELQDE  240
QMLAKIARVA VQKFASLASS SSPLWLSVSG DSLETLNKMA YVQAIPWQNS VMGLKIETTR  300
ANAVVMMDSQ NVVGFLMDAE SYGTYFPGIM FGGTATKVYN WPSDRNAGYD GAMELLTAEV  360
VFPSPLIPAR KCTFLRCCKK LENGATAVID IAVQNIAGNF LKYRKVASGL LIQPIKPDSC  420
KITAIEHVRV DDAGIHDLFK PCLSALLFGA RRWVVSMARQ CARIRDVYHV TAIEHVRVDD  480
AGIHDLFKPC LSALLFGARR WVVSMARQCA RIRDVYHVTN SPMGGNGNLQ ISE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660716.11e-148PREDICTED: homeobox-leucine zipper protein TF1
TrEMBLK3XF211e-148K3XF21_SETIT; Uncharacterized protein
STRINGSi000488m1e-147(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.19e-59protodermal factor 2